BLASTX 2.2.3 [Apr-24-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 603002254F1
         (628 letters)

Database: sp_tr_nrdb 
           1,272,877 sequences; 406,886,216 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q96FH0 (Q96FH0) Similar to RIKEN cDNA 2310045N01 gene                 160   1e-38
Q9D6Y4 (Q9D6Y4) 2310045N01Rik protein                                 157   1e-37
Q9BT01 (Q9BT01) Similar to RIKEN cDNA 2310045N01 gene                 155   5e-37
Q9BWB3 (Q9BWB3) Hypothetical protein (Fragment)                       155   5e-37
EAA10220 (EAA10220) AgCP15219 (Fragment)                               83   3e-15
Q8IR45 (Q8IR45) CG32590-PA                                             72   7e-12
O45685 (O45685) K11B4.2 protein                                        59   5e-08

>Q96FH0 (Q96FH0) Similar to RIKEN cDNA 2310045N01 gene
          Length = 119

 Score =  160 bits (405), Expect = 1e-38
 Identities = 80/111 (72%), Positives = 95/111 (85%), Gaps = 1/111 (0%)
 Frame = +1

Query: 55  KLQSKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEYAC 234
           K+  KFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQSQGAIYTVEYAC
Sbjct: 12  KVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYAC 71

Query: 235 SAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNA-AQGRSAVAPQAKNPPGSS 384
           SA+K++ DSSVYF+S++ LLK AI+++D +NA AQG S   P+   PP S+
Sbjct: 72  SAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHS---PEEPPPPSSA 119


>Q9D6Y4 (Q9D6Y4) 2310045N01Rik protein
          Length = 120

 Score =  157 bits (396), Expect = 1e-37
 Identities = 79/110 (71%), Positives = 94/110 (84%), Gaps = 1/110 (0%)
 Frame = +1

Query: 55  KLQSKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEYAC 234
           K+  KFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQSQGAIYTVEYAC
Sbjct: 12  KVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYAC 71

Query: 235 SAIKSMTDSSVYFKSIDSLLKHAIAMKDQLN-AAQGRSAVAPQAKNPPGS 381
           SA+KS+ DSSVYF+S++ LLK AI+++D +N +AQG S    +  +PP S
Sbjct: 72  SAVKSLVDSSVYFRSVEGLLKQAISIRDHMNTSAQGHS---QEKLSPPPS 118


>Q9BT01 (Q9BT01) Similar to RIKEN cDNA 2310045N01 gene
          Length = 109

 Score =  155 bits (391), Expect = 5e-37
 Identities = 75/96 (78%), Positives = 88/96 (91%), Gaps = 1/96 (1%)
 Frame = +1

Query: 55  KLQSKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEYAC 234
           K+  KFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQSQGAIYTVEYAC
Sbjct: 12  KVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYAC 71

Query: 235 SAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNA-AQG 339
           SA+K++ DSSVYF+S++ LLK AI+++D +NA AQG
Sbjct: 72  SAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQG 107


>Q9BWB3 (Q9BWB3) Hypothetical protein (Fragment)
          Length = 119

 Score =  155 bits (391), Expect = 5e-37
 Identities = 75/96 (78%), Positives = 88/96 (91%), Gaps = 1/96 (1%)
 Frame = +1

Query: 55  KLQSKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEYAC 234
           K+  KFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQSQGAIYTVEYAC
Sbjct: 22  KVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYAC 81

Query: 235 SAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNA-AQG 339
           SA+K++ DSSVYF+S++ LLK AI+++D +NA AQG
Sbjct: 82  SAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQG 117


>EAA10220 (EAA10220) AgCP15219 (Fragment)
          Length = 196

 Score = 82.8 bits (203), Expect = 3e-15
 Identities = 36/96 (37%), Positives = 62/96 (64%)
 Frame = +1

Query: 55  KLQSKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEYAC 234
           K   K +E+M+++ANEPS+A YR+QEHVR+ +P + + ++++   ++  QG  Y +EYA 
Sbjct: 30  KTTEKISENMHIIANEPSLAFYRIQEHVRKVIPLIVERRAEVVQLQQDLQGKCYDMEYAI 89

Query: 235 SAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNAAQGR 342
            A+K +  +    K++  LLK+AI +K QL   + R
Sbjct: 90  GAVKDIEAADTSLKNVQELLKNAIFLKQQLKYVESR 125


>Q8IR45 (Q8IR45) CG32590-PA
          Length = 183

 Score = 71.6 bits (174), Expect = 7e-12
 Identities = 34/118 (28%), Positives = 64/118 (53%)
 Frame = +1

Query: 55  KLQSKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEYAC 234
           K   K +E++++ AN+PS+A +R+QEHVR+  P + + + ++   +   QG  Y +EY  
Sbjct: 13  KTSEKISENIHIFANDPSLAFFRVQEHVRKVTPAIFEKRDEVFQLQNNLQGHCYDMEYGI 72

Query: 235 SAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNAAQGRSAVAPQAKNPPGSS*FQTRLAV 408
            A++++  S   F++I  ++K +I +K QL   + R  V   +        F   LA+
Sbjct: 73  QALRTIEKSESIFENIQEMIKASIFLKQQLKYEESRKKVKKDSTKSSVYKRFSAHLAL 130


>O45685 (O45685) K11B4.2 protein
          Length = 151

 Score = 58.9 bits (141), Expect = 5e-08
 Identities = 34/99 (34%), Positives = 52/99 (52%)
 Frame = +1

Query: 58  LQSKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEYACS 237
           +  +  ES+ +L NEPS+ALYRLQEH  RSLP L   +  +        GA + +E   S
Sbjct: 21  ISERICESVRLLDNEPSLALYRLQEHTVRSLPGLVNRRIMLTQQSATLSGAQFDLENTLS 80

Query: 238 AIKSMTDSSVYFKSIDSLLKHAIAMKDQLNAAQGRSAVA 354
              SM +++  F +   LL++ +  K QL+    R A +
Sbjct: 81  TTTSMQNATSAFDNCIELLRNCMFYKQQLDFDSTRKATS 119


  Database: sp_tr_nrdb
    Posted date:  Sep 24, 2003  2:13 PM
  Number of letters in database: 406,886,216
  Number of sequences in database:  1,272,877
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 517,927,393
Number of Sequences: 1272877
Number of extensions: 11180005
Number of successful extensions: 33889
Number of sequences better than 1.0e-03: 14
Number of HSP's better than  0.0 without gapping: 32133
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33853
length of database: 406,886,216
effective HSP length: 117
effective length of database: 257,959,607
effective search space used: 23474324237
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)