BLASTX 2.2.3 [Apr-24-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 603103685F1
         (625 letters)

Database: sp_tr_nrdb 
           1,272,877 sequences; 406,886,216 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

RL18_HUMAN (Q07020) 60S ribosomal protein L18                         194   3e-62
AAH53777 (AAH53777) Hypothetical protein                              187   2e-60
AAH53773 (AAH53773) Hypothetical protein                              186   5e-60
RL18_XENLA (P02412) 60S ribosomal protein L18 (L14B)                  182   7e-59
Q86LX2 (Q86LX2) Ribosomal protein L18 (Fragment)                      171   3e-51
RL18_RAT (P12001) 60S ribosomal protein L18                           192   4e-48
RL18_MOUSE (P35980) 60S ribosomal protein L18                         192   4e-48
RL18_OREMO (Q9I836) 60S ribosomal protein L18                         186   2e-46
RLNA_XENLA (P09897) 60S ribosomal protein L14A                        183   1e-45
RL18_ICTPU (Q90YV0) 60S ribosomal protein L18                         180   1e-44
Q9W6X7 (Q9W6X7) Ribosomal protein L18 (Fragment)                      177   7e-44
Q9VS34 (Q9VS34) CG8615 protein (Ribosomal protein L18) (RH0           142   7e-43
Q801H3 (Q801H3) Ribosomal protein L18 (Fragment)                      173   2e-42
Q962Y8 (Q962Y8) Ribosomal protein L18                                 146   6e-42
EAA04761 (EAA04761) AgCP3167 (Fragment)                               137   2e-41
RL18_PIG (Q95342) 60S ribosomal protein L18 (Fragment)                166   3e-40
Q98SG3 (Q98SG3) Ribosomal protein L18 (Fragment)                      162   3e-39
Q94GV7 (Q94GV7) Cytoplasmic ribosomal protein L18                     123   7e-37
Q84U89 (Q84U89) 60S ribosomal protein (Fragment)                      126   2e-36
EAA27337 (EAA27337) Hypothetical protein                              128   3e-36
Q801I8 (Q801I8) Ribosomal protein L18 (Fragment)                      151   5e-36
Q8TFH1 (Q8TFH1) 60S ribosomal protein L18                             122   2e-35
BAC83538 (BAC83538) Putative cytoplasmic ribosomal protein            119   2e-35
RL18_SCHPO (Q10192) 60S ribosomal protein L18                         122   2e-35
RL18_SALSA (P24558) 60S ribosomal protein L18                         128   5e-35
RL18_CICAR (O65729) 60S ribosomal protein L18 (Fragment)              118   1e-34
RL18_ARATH (P42791) 60S ribosomal protein L18                         118   4e-34
Q940B0 (Q940B0) Putative 60S ribosomal protein                        117   7e-34
RL18_YEAST (P07279) 60S ribosomal protein L18 (RP28)                  115   1e-31
Q86LY7 (Q86LY7) Ribosomal protein L18 (Fragment)                      132   4e-30
EAA20707 (EAA20707) Eukaryotic ribosomal protein L18, putat            96   3e-29
O45946 (O45946) Y45F10D.12 protein                                    128   6e-29
Q8IDS5 (Q8IDS5) 60S ribosomal subunit porotein L18, putativ            89   7e-27
RL18_TRYBB (P50885) 60S ribosomal protein L18                          91   6e-24
Q9U5R6 (Q9U5R6) Putative ribosomal protein L18 (Fragment)              77   4e-23
Q9GRJ5 (Q9GRJ5) Ribosomal protein L18                                  87   1e-22
Q8UW20 (Q8UW20) Ribosomal protein L14 (Fragment)                       97   2e-19
EAA37305 (EAA37305) GLP_66_20117_19578                                 88   2e-18
Q8T6A0 (Q8T6A0) 60S ribosomal protein L18                              55   4e-16
O22254 (O22254) 60S ribosomal protein L18, 5'partial (Fragm            55   3e-15
AAQ56708 (AAQ56708) Ribosomal protein L18-like (Fragment)              63   3e-09
Q9BML2 (Q9BML2) Putative ribosomal protein (Fragment)                  61   1e-08
Q8SS76 (Q8SS76) 60S ribosomal protein L18                              59   5e-08
Q98RU3 (Q98RU3) 60s ribosomal protein L18                              48   8e-05

>RL18_HUMAN (Q07020) 60S ribosomal protein L18
          Length = 187

 Score =  194 bits (492), Expect(2) = 3e-62
 Identities = 98/117 (83%), Positives = 104/117 (88%)
 Frame = +2

Query: 26  GVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPL 205
           GVDIRHN+DRKVRR+EPKSQDIYLRLLVKLYRFLARRTNS FN+VVLKRLFMSRTNRPPL
Sbjct: 1   GVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPL 60

Query: 206 ALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           +LSRMIRKMKLPGRENKTA          R+QEVPKLKVCALRVT  AR+RILRAGG
Sbjct: 61  SLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCALRVTSRARSRILRAGG 117



 Score = 67.0 bits (162), Expect(2) = 3e-62
 Identities = 32/41 (78%), Positives = 35/41 (85%)
 Frame = +1

Query: 400 LAMAAPKGKGTVLLSGPRKGREVYRHFGKAPGTPQQTHQDP 522
           LA+ +PKG GTVLLSGPRKGREVYRHFGKAPGTP  +H  P
Sbjct: 125 LALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTP-HSHTKP 164



 Score = 58.9 bits (141), Expect = 5e-08
 Identities = 36/73 (49%), Positives = 41/73 (55%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG +LTFDQ      +  G       ++G   V      A   P    +PYVRSKGRKFE
Sbjct: 116 GGKILTFDQLALDSPKGCGTVLLSGPRKGR-EVYRHFGKAPGTPHSHTKPYVRSKGRKFE 174

Query: 552 RARGRRASRGYKN 590
           RARGRRASRGYKN
Sbjct: 175 RARGRRASRGYKN 187


>AAH53777 (AAH53777) Hypothetical protein
          Length = 188

 Score =  187 bits (476), Expect(2) = 2e-60
 Identities = 91/118 (77%), Positives = 105/118 (88%)
 Frame = +2

Query: 23  MGVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPP 202
           MG+DIRHN+DRKVRR+EPKSQDIYLRLLVKLYRFLARRTNS+FN+VVLKRLFMSRTNRPP
Sbjct: 1   MGIDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSSFNRVVLKRLFMSRTNRPP 60

Query: 203 LALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           L++SR+IRKMKLPGRENKTA          RI ++PKL VCAL++T GAR+RIL+AGG
Sbjct: 61  LSMSRLIRKMKLPGRENKTAVVVGCITDDVRIHDIPKLTVCALKLTSGARSRILKAGG 118



 Score = 66.6 bits (161), Expect(2) = 2e-60
 Identities = 30/34 (88%), Positives = 32/34 (93%)
 Frame = +1

Query: 400 LAMAAPKGKGTVLLSGPRKGREVYRHFGKAPGTP 501
           LA+AAPKG+ TVLLSGPRK REVYRHFGKAPGTP
Sbjct: 126 LALAAPKGQNTVLLSGPRKAREVYRHFGKAPGTP 159



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 33/73 (45%), Positives = 41/73 (55%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG ++TFDQ      + + ++  +     A  V      A   P    +PYV SKGRKFE
Sbjct: 117 GGQIMTFDQLALAAPKGQ-NTVLLSGPRKAREVYRHFGKAPGTPHSRTKPYVLSKGRKFE 175

Query: 552 RARGRRASRGYKN 590
           RARGRRASRGYKN
Sbjct: 176 RARGRRASRGYKN 188


>AAH53773 (AAH53773) Hypothetical protein
          Length = 188

 Score =  186 bits (473), Expect(2) = 5e-60
 Identities = 90/118 (76%), Positives = 105/118 (88%)
 Frame = +2

Query: 23  MGVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPP 202
           MG+DIRHN+DRKVRR+EPKSQDIYLRLLVKLYRFLARRTNS+FN+VVLKRLFMSRTNRPP
Sbjct: 1   MGIDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSSFNRVVLKRLFMSRTNRPP 60

Query: 203 LALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           L++SR+IRKMKL GRENKTA          RI ++PKLKVCAL++T GAR+RIL++GG
Sbjct: 61  LSMSRLIRKMKLQGRENKTAVVVGCITDDVRIHDIPKLKVCALKITSGARSRILKSGG 118



 Score = 66.6 bits (161), Expect(2) = 5e-60
 Identities = 30/34 (88%), Positives = 32/34 (93%)
 Frame = +1

Query: 400 LAMAAPKGKGTVLLSGPRKGREVYRHFGKAPGTP 501
           LA+AAPKG+ TVLLSGPRK REVYRHFGKAPGTP
Sbjct: 126 LALAAPKGQNTVLLSGPRKAREVYRHFGKAPGTP 159



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 33/73 (45%), Positives = 41/73 (55%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG ++TFDQ      + + ++  +     A  V      A   P    +PYV SKGRKFE
Sbjct: 117 GGQIMTFDQLALAAPKGQ-NTVLLSGPRKAREVYRHFGKAPGTPHSRTKPYVLSKGRKFE 175

Query: 552 RARGRRASRGYKN 590
           RARGRRASRGYKN
Sbjct: 176 RARGRRASRGYKN 188


>RL18_XENLA (P02412) 60S ribosomal protein L18 (L14B)
          Length = 187

 Score =  182 bits (463), Expect(2) = 7e-59
 Identities = 88/117 (75%), Positives = 103/117 (87%)
 Frame = +2

Query: 26  GVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPL 205
           G+DIRHN+DRKVRR+EPKSQDIYLRLLVKLYRFLARRTNS+FN+VVLKRLFMSRTNRPPL
Sbjct: 1   GIDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSSFNRVVLKRLFMSRTNRPPL 60

Query: 206 ALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           ++SR+IRKMKL GRENKTA          RI ++PKLKVCAL++T G R+RIL++GG
Sbjct: 61  SMSRLIRKMKLQGRENKTAVVVGYITDDVRIHDIPKLKVCALKITSGDRSRILKSGG 117



 Score = 66.6 bits (161), Expect(2) = 7e-59
 Identities = 30/34 (88%), Positives = 32/34 (93%)
 Frame = +1

Query: 400 LAMAAPKGKGTVLLSGPRKGREVYRHFGKAPGTP 501
           LA+AAPKG+ TVLLSGPRK REVYRHFGKAPGTP
Sbjct: 125 LALAAPKGQNTVLLSGPRKAREVYRHFGKAPGTP 158



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 33/73 (45%), Positives = 41/73 (55%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG ++TFDQ      + + ++  +     A  V      A   P    +PYV SKGRKFE
Sbjct: 116 GGQIMTFDQLALAAPKGQ-NTVLLSGPRKAREVYRHFGKAPGTPHSRTKPYVLSKGRKFE 174

Query: 552 RARGRRASRGYKN 590
           RARGRRASRGYKN
Sbjct: 175 RARGRRASRGYKN 187


>Q86LX2 (Q86LX2) Ribosomal protein L18 (Fragment)
          Length = 188

 Score =  171 bits (432), Expect(2) = 3e-51
 Identities = 82/118 (69%), Positives = 99/118 (83%)
 Frame = +2

Query: 23  MGVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPP 202
           MG+DI H RDR+VRR+EPKS+DIYLRLLVKLYRFLARRTN+ FN+VVL+RLFMSRTNRPP
Sbjct: 1   MGIDIDHRRDRRVRRKEPKSEDIYLRLLVKLYRFLARRTNAKFNQVVLERLFMSRTNRPP 60

Query: 203 LALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           ++++R+IR MK PGRE KTA          RI E+PKLK+C LRVT+GAR +IL+AGG
Sbjct: 61  MSIARLIRLMKKPGREGKTAVVVGTITDDVRIFEIPKLKICCLRVTEGARAKILKAGG 118



 Score = 53.1 bits (126), Expect(2) = 3e-51
 Identities = 31/72 (43%), Positives = 40/72 (55%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG ++TFDQ     S +  ++  ++ Q  A         A   P    +P+VRSKGRKFE
Sbjct: 117 GGEIITFDQLALR-SPKGKNTVLIQGQRRARETCRHWGPAPGVPHSHTKPFVRSKGRKFE 175

Query: 552 RARGRRASRGYK 587
           RARGRR S GYK
Sbjct: 176 RARGRRKSCGYK 187



 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 22/41 (53%), Positives = 28/41 (67%)
 Frame = +1

Query: 400 LAMAAPKGKGTVLLSGPRKGREVYRHFGKAPGTPQQTHQDP 522
           LA+ +PKGK TVL+ G R+ RE  RH+G APG P  +H  P
Sbjct: 126 LALRSPKGKNTVLIQGQRRARETCRHWGPAPGVP-HSHTKP 165


>RL18_RAT (P12001) 60S ribosomal protein L18
          Length = 187

 Score =  192 bits (487), Expect = 4e-48
 Identities = 106/164 (64%), Positives = 116/164 (70%)
 Frame = +2

Query: 26  GVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPL 205
           GVDIRHN+DRKVRR+EPKSQDIYLRLLVKLYRFLARRTNS FN+VVLKRLFMSRTNRPPL
Sbjct: 1   GVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPL 60

Query: 206 ALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGGVGP 385
           +LSRMIRKMKLPGRENKTA          RI EVPKLKVCALRV+  AR+RIL+AGG   
Sbjct: 61  SLSRMIRKMKLPGRENKTAVVVGTITDDVRILEVPKLKVCALRVSSRARSRILKAGGKIL 120

Query: 386 HLRPIWPWLLPKGRAQXXXXXXXXXXXXXXTSGRRPERPNRHTK 517
               +     PKGR                  G+ P  P+ HTK
Sbjct: 121 TFDQL-ALESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTK 163



 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 36/73 (49%), Positives = 41/73 (55%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG +LTFDQ      +  G       ++G   V      A   P    +PYVRSKGRKFE
Sbjct: 116 GGKILTFDQLALESPKGRGTVLLSGPRKGR-EVYRHFGKAPGTPHSHTKPYVRSKGRKFE 174

Query: 552 RARGRRASRGYKN 590
           RARGRRASRGYKN
Sbjct: 175 RARGRRASRGYKN 187


>RL18_MOUSE (P35980) 60S ribosomal protein L18
          Length = 187

 Score =  192 bits (487), Expect = 4e-48
 Identities = 106/164 (64%), Positives = 116/164 (70%)
 Frame = +2

Query: 26  GVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPL 205
           GVDIRHN+DRKVRR+EPKSQDIYLRLLVKLYRFLARRTNS FN+VVLKRLFMSRTNRPPL
Sbjct: 1   GVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPL 60

Query: 206 ALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGGVGP 385
           +LSRMIRKMKLPGRENKTA          RI EVPKLKVCALRV+  AR+RIL+AGG   
Sbjct: 61  SLSRMIRKMKLPGRENKTAVVVGTVTDDVRILEVPKLKVCALRVSSRARSRILKAGGKIL 120

Query: 386 HLRPIWPWLLPKGRAQXXXXXXXXXXXXXXTSGRRPERPNRHTK 517
               +     PKGR                  G+ P  P+ HTK
Sbjct: 121 TFDQL-ALESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTK 163



 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 36/73 (49%), Positives = 41/73 (55%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG +LTFDQ      +  G       ++G   V      A   P    +PYVRSKGRKFE
Sbjct: 116 GGKILTFDQLALESPKGRGTVLLSGPRKGR-EVYRHFGKAPGTPHSHTKPYVRSKGRKFE 174

Query: 552 RARGRRASRGYKN 590
           RARGRRASRGYKN
Sbjct: 175 RARGRRASRGYKN 187


>RL18_OREMO (Q9I836) 60S ribosomal protein L18
          Length = 187

 Score =  186 bits (473), Expect = 2e-46
 Identities = 98/164 (59%), Positives = 115/164 (69%)
 Frame = +2

Query: 26  GVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPL 205
           GVDIRHN+DRKV R+EPKSQDIYLRLLVKLYRFLARR+N+ FN+VVL+RLFMSRTNRPP+
Sbjct: 1   GVDIRHNKDRKVHRKEPKSQDIYLRLLVKLYRFLARRSNAPFNRVVLRRLFMSRTNRPPI 60

Query: 206 ALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGGVGP 385
           A+SR+IRKMKLPGRENK A          RIQ++PKLK+CALRVT GAR RIL+AGG   
Sbjct: 61  AVSRLIRKMKLPGRENKIAVVVGTVTDDVRIQDIPKLKICALRVTDGARRRILKAGGQVM 120

Query: 386 HLRPIWPWLLPKGRAQXXXXXXXXXXXXXXTSGRRPERPNRHTK 517
               +     PKG+                  G+ P  P+ HTK
Sbjct: 121 TFDQL-ALASPKGQGTVLLSGPRKAREVYRHFGKAPGTPHSHTK 163



 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 35/73 (47%), Positives = 41/73 (55%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG V+TFDQ      + +G +  +     A  V      A   P    +PYVRSKGRKFE
Sbjct: 116 GGQVMTFDQLALASPKGQG-TVLLSGPRKAREVYRHFGKAPGTPHSHTKPYVRSKGRKFE 174

Query: 552 RARGRRASRGYKN 590
           RARGRRAS GYKN
Sbjct: 175 RARGRRASCGYKN 187


>RLNA_XENLA (P09897) 60S ribosomal protein L14A
          Length = 187

 Score =  183 bits (465), Expect = 1e-45
 Identities = 97/164 (59%), Positives = 115/164 (69%)
 Frame = +2

Query: 26  GVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPL 205
           G+DIRHN+DRKVRR+EPKSQDIYLRLLVKLYRFLARRTNS+FN+VVLKRLFMSRTNRPPL
Sbjct: 1   GIDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSSFNRVVLKRLFMSRTNRPPL 60

Query: 206 ALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGGVGP 385
           ++SR+IRKMKLP RENKTA          RI ++PKL VCAL++T GAR+RIL+AGG   
Sbjct: 61  SMSRLIRKMKLPRRENKTAVVVGCITADVRIHDIPKLTVCALKLTSGARSRILKAGGQIM 120

Query: 386 HLRPIWPWLLPKGRAQXXXXXXXXXXXXXXTSGRRPERPNRHTK 517
               +     PKG+                  G+ P  P+  TK
Sbjct: 121 TFDQL-ALAAPKGQNTVLLSGPRKAREVYRHFGKAPSTPHSRTK 163



 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 33/73 (45%), Positives = 42/73 (57%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG ++TFDQ      + + ++  +     A  V      A + P    +PYV SKGRKFE
Sbjct: 116 GGQIMTFDQLALAAPKGQ-NTVLLSGPRKAREVYRHFGKAPSTPHSRTKPYVLSKGRKFE 174

Query: 552 RARGRRASRGYKN 590
           RARGRRASRGYKN
Sbjct: 175 RARGRRASRGYKN 187


>RL18_ICTPU (Q90YV0) 60S ribosomal protein L18
          Length = 187

 Score =  180 bits (457), Expect = 1e-44
 Identities = 99/164 (60%), Positives = 111/164 (67%)
 Frame = +2

Query: 26  GVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPL 205
           GVDIRHN+DRKV R EPKSQDIYLRLLVKLYRFLARR+++ FNKVVLKRLFMS+TNRPPL
Sbjct: 1   GVDIRHNKDRKVHRTEPKSQDIYLRLLVKLYRFLARRSDAPFNKVVLKRLFMSKTNRPPL 60

Query: 206 ALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGGVGP 385
           ALSR+IRKMKL GRENK A          RI  +PKLKVCALRVT GAR RIL+AGG   
Sbjct: 61  ALSRLIRKMKLQGRENKIAVVVGTITDDVRILNIPKLKVCALRVTAGARRRILKAGGQVM 120

Query: 386 HLRPIWPWLLPKGRAQXXXXXXXXXXXXXXTSGRRPERPNRHTK 517
               +     PKG+                  G+ P  P+ HTK
Sbjct: 121 TFDQL-AVTTPKGQGTVLLSGPRKAREVYRHFGKAPGTPHSHTK 163



 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 35/73 (47%), Positives = 42/73 (56%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG V+TFDQ      + +G +  +     A  V      A   P    +PY+RSKGRKFE
Sbjct: 116 GGQVMTFDQLAVTTPKGQG-TVLLSGPRKAREVYRHFGKAPGTPHSHTKPYIRSKGRKFE 174

Query: 552 RARGRRASRGYKN 590
           RARGRRASRGYKN
Sbjct: 175 RARGRRASRGYKN 187


>Q9W6X7 (Q9W6X7) Ribosomal protein L18 (Fragment)
          Length = 131

 Score =  177 bits (450), Expect = 7e-44
 Identities = 87/118 (73%), Positives = 99/118 (83%)
 Frame = +2

Query: 23  MGVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPP 202
           MGVDIRHN+DRKV R+EPKSQDIYLRLLVKLYRFL+RRTN+ FNKVVLKRLFMSRTNRPP
Sbjct: 1   MGVDIRHNKDRKVHRKEPKSQDIYLRLLVKLYRFLSRRTNAPFNKVVLKRLFMSRTNRPP 60

Query: 203 LALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           +A+SR+IRKMKLPGR+NK A           I E+PKLK+CAL+VT GAR RIL + G
Sbjct: 61  IAISRLIRKMKLPGRDNKIAVVVGTVTDDVTIHEIPKLKICALKVTDGARRRILNSRG 118


>Q9VS34 (Q9VS34) CG8615 protein (Ribosomal protein L18) (RH0
          Length = 188

 Score =  142 bits (357), Expect(2) = 7e-43
 Identities = 71/118 (60%), Positives = 83/118 (70%)
 Frame = +2

Query: 23  MGVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPP 202
           MG+DI H  DRKVRR EPKSQD+YLRLLVKLYRFL RRTN  FN+++LKRLFMS+ NRPP
Sbjct: 1   MGIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPP 60

Query: 203 LALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           L+L R+ R  K   +   T           R+  VPKL VCAL VT+ AR RIL+AGG
Sbjct: 61  LSLQRIARFFKAANQPESTIVVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGG 118



 Score = 53.9 bits (128), Expect(2) = 7e-43
 Identities = 34/72 (47%), Positives = 40/72 (55%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG VLTFDQ     S    ++  ++ +  A         A   P    RPYVRSKGRKFE
Sbjct: 117 GGEVLTFDQLALR-SPTGKNTLLLQGRRTARTACKHFGKAPGVPHSHTRPYVRSKGRKFE 175

Query: 552 RARGRRASRGYK 587
           RARGRR+S GYK
Sbjct: 176 RARGRRSSCGYK 187


>Q801H3 (Q801H3) Ribosomal protein L18 (Fragment)
          Length = 188

 Score =  173 bits (438), Expect = 2e-42
 Identities = 94/165 (56%), Positives = 112/165 (66%)
 Frame = +2

Query: 23  MGVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPP 202
           MG+DIRHN+DRKVRR EP+S+DIYLRLLVKLYRFLARRT+S FNKVVLKRLFMSRTNRPP
Sbjct: 1   MGIDIRHNKDRKVRRTEPRSEDIYLRLLVKLYRFLARRTSSPFNKVVLKRLFMSRTNRPP 60

Query: 203 LALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGGVG 382
           ++++R++RKMK+ GRE K A          RI  +PK+KVCALRVT  AR RILRAGG  
Sbjct: 61  ISIARLVRKMKMGGREGKVAVVIGTITDDPRIFTIPKIKVCALRVTAKARDRILRAGGEV 120

Query: 383 PHLRPIWPWLLPKGRAQXXXXXXXXXXXXXXTSGRRPERPNRHTK 517
             L  +   L P+G+                  G  P  P+ HTK
Sbjct: 121 LTLDQL-ALLSPRGQNTVLLSGPRKGREAYRHFGPAPGVPHSHTK 164



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 38/75 (50%), Positives = 42/75 (55%), Gaps = 2/75 (2%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALRE--GARNAPTDTPRPYVRSKGRK 545
           GG VLT DQ     S R  ++  +       G  A R    A   P    +PYVRSKGRK
Sbjct: 117 GGEVLTLDQLAL-LSPRGQNTVLLSGPRK--GREAYRHFGPAPGVPHSHTKPYVRSKGRK 173

Query: 546 FERARGRRASRGYKN 590
           FERARGRRASRGYKN
Sbjct: 174 FERARGRRASRGYKN 188


>Q962Y8 (Q962Y8) Ribosomal protein L18
          Length = 183

 Score =  146 bits (369), Expect(2) = 6e-42
 Identities = 74/118 (62%), Positives = 86/118 (72%)
 Frame = +2

Query: 23  MGVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPP 202
           MG+DI H  DRKVRR E KSQD+YLRLLVKLYR+LARRTNS FN ++L+RLFMSR NRPP
Sbjct: 1   MGIDINHKHDRKVRRTEVKSQDVYLRLLVKLYRYLARRTNSKFNTIILRRLFMSRINRPP 60

Query: 203 LALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           L+LSR+ R MK P RE   A          R+ +VPK+ V AL VT+ AR RIL AGG
Sbjct: 61  LSLSRLARHMKKPTREGMIAVVVGTITNDVRLYKVPKMSVAALHVTEKARARILAAGG 118



 Score = 46.2 bits (108), Expect(2) = 6e-42
 Identities = 23/41 (56%), Positives = 26/41 (63%)
 Frame = +1

Query: 400 LAMAAPKGKGTVLLSGPRKGREVYRHFGKAPGTPQQTHQDP 522
           LA+ AP G  TVLL G R  RE  RHFG APG P ++H  P
Sbjct: 126 LALRAPTGAKTVLLQGRRNAREAVRHFGPAPGAP-RSHTKP 165


>EAA04761 (EAA04761) AgCP3167 (Fragment)
          Length = 202

 Score =  137 bits (344), Expect(2) = 2e-41
 Identities = 70/119 (58%), Positives = 85/119 (70%), Gaps = 1/119 (0%)
 Frame = +2

Query: 23  MGVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPP 202
           MG+DI H  DRKVRR  PKS D+YL LLVKLYRFL RRT   FNK+V++RLFMSRTN PP
Sbjct: 14  MGIDINHKWDRKVRRTRPKSLDVYLSLLVKLYRFLYRRTKKKFNKIVMRRLFMSRTNHPP 73

Query: 203 LALSRMIRKMKLPGRENKT-AXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           ++L+R+   MKL G++ K+ A          R+ +VPKL VCALRVT  AR RIL+ GG
Sbjct: 74  MSLNRVAHLMKLRGKDEKSVAVVIGTVTNDVRMMDVPKLNVCALRVTDKARQRILKNGG 132



 Score = 53.9 bits (128), Expect(2) = 2e-41
 Identities = 32/73 (43%), Positives = 41/73 (55%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG + TFDQ     S    ++  ++ +  A  V      A   P    RPYV+SKGRKFE
Sbjct: 131 GGKIYTFDQLAL-LSPTGRNTVLMQGKRTAREVFKHFGRAPGVPHSNTRPYVQSKGRKFE 189

Query: 552 RARGRRASRGYKN 590
           +ARGRR+S GYKN
Sbjct: 190 KARGRRSSCGYKN 202


>RL18_PIG (Q95342) 60S ribosomal protein L18 (Fragment)
          Length = 103

 Score =  166 bits (419), Expect = 3e-40
 Identities = 84/103 (81%), Positives = 88/103 (84%)
 Frame = +2

Query: 26  GVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPL 205
           GVDIRHN+DRKVRR+EPKSQDIYLRLLVKL RFLARRTNS FN+VVLKRLFMSRTNRPPL
Sbjct: 1   GVDIRHNKDRKVRRKEPKSQDIYLRLLVKLXRFLARRTNSTFNQVVLKRLFMSRTNRPPL 60

Query: 206 ALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALR 334
           +LSRM RKMKLPGRE KTA          R QEVPKLKVCALR
Sbjct: 61  SLSRMXRKMKLPGREGKTAVVVGTITDDVRFQEVPKLKVCALR 103


>Q98SG3 (Q98SG3) Ribosomal protein L18 (Fragment)
          Length = 180

 Score =  162 bits (410), Expect = 3e-39
 Identities = 88/158 (55%), Positives = 107/158 (67%)
 Frame = +2

Query: 44  NRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPLALSRMI 223
           N+DRKVR +EPKSQDIYLRLL KLYRFLARR+ + FNKVVL+ LFMSRT+RPP+++SRMI
Sbjct: 1   NKDRKVRPKEPKSQDIYLRLLDKLYRFLARRSTAPFNKVVLRWLFMSRTHRPPMSVSRMI 60

Query: 224 RKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGGVGPHLRPIW 403
           RKMKLPGREN+TA          RIQ++PKLKVCAL+VT+  RTRIL+AGG       + 
Sbjct: 61  RKMKLPGRENRTAVVVGTVTDDVRIQDIPKLKVCALKVTRRLRTRILKAGGQIMTFDQL- 119

Query: 404 PWLLPKGRAQXXXXXXXXXXXXXXTSGRRPERPNRHTK 517
               PKG+                  G+ P  P+ HTK
Sbjct: 120 ALAAPKGQGTVLLSGPRKAPDVSRHFGKVPGTPHSHTK 157



 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 34/72 (47%), Positives = 41/72 (56%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG ++TFDQ      + +G +  +     A  VS         P    +PYVRSKGRKFE
Sbjct: 110 GGQIMTFDQLALAAPKGQG-TVLLSGPRKAPDVSRHFGKVPGTPHSHTKPYVRSKGRKFE 168

Query: 552 RARGRRASRGYK 587
           RARGRRASRGYK
Sbjct: 169 RARGRRASRGYK 180


>Q94GV7 (Q94GV7) Cytoplasmic ribosomal protein L18
          Length = 188

 Score =  123 bits (308), Expect(2) = 7e-37
 Identities = 65/119 (54%), Positives = 83/119 (69%), Gaps = 1/119 (0%)
 Frame = +2

Query: 23  MGVD-IRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRP 199
           MG+D +   R++K +R  P+S D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TNRP
Sbjct: 1   MGIDLVAGGRNKKTKRTAPRSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP 60

Query: 200 PLALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           PL+L R+ + M+    EN  A          RIQE+PK+KV ALR T+ AR RI+ AGG
Sbjct: 61  PLSLRRLAKFME-GKEENNIAVIVGTVTDDKRIQEIPKMKVTALRFTETARARIVNAGG 118



 Score = 52.8 bits (125), Expect(2) = 7e-37
 Identities = 32/72 (44%), Positives = 39/72 (53%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG  LTFDQ        E ++  +R  + A         A   P    +PYVRSKGRKFE
Sbjct: 117 GGECLTFDQLALRAPLGE-NTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRSKGRKFE 175

Query: 552 RARGRRASRGYK 587
           +ARGRR SRG+K
Sbjct: 176 KARGRRNSRGFK 187



 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 24/41 (58%), Positives = 28/41 (67%)
 Frame = +1

Query: 400 LAMAAPKGKGTVLLSGPRKGREVYRHFGKAPGTPQQTHQDP 522
           LA+ AP G+ TVLL GP+  RE  RHFGKAPG P  +H  P
Sbjct: 126 LALRAPLGENTVLLRGPKNAREAVRHFGKAPGVP-HSHTKP 165


>Q84U89 (Q84U89) 60S ribosomal protein (Fragment)
          Length = 164

 Score =  126 bits (316), Expect(2) = 2e-36
 Identities = 67/119 (56%), Positives = 84/119 (70%), Gaps = 1/119 (0%)
 Frame = +2

Query: 23  MGVDIRHN-RDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRP 199
           MG+D++   + +K +R  PKS DIYL+LLVKLYRFL RRT S FNKV+LKRLFMS+ N+P
Sbjct: 1   MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKP 60

Query: 200 PLALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           PL+LSR+IR  K  G+E K A          R+ EVP +KV ALR T+ AR RI +AGG
Sbjct: 61  PLSLSRLIRYTK--GKEGKIAVVVGAVTDDIRVYEVPAIKVTALRFTEKARARIEKAGG 117



 Score = 48.5 bits (114), Expect(2) = 2e-36
 Identities = 20/37 (54%), Positives = 26/37 (70%)
 Frame = +1

Query: 400 LAMAAPKGKGTVLLSGPRKGREVYRHFGKAPGTPQQT 510
           LA+ AP G+ TVLL GP+  RE  +HFG+APG P  +
Sbjct: 125 LALKAPLGQNTVLLRGPKNAREAVKHFGRAPGVPHSS 161


>EAA27337 (EAA27337) Hypothetical protein
          Length = 183

 Score =  128 bits (321), Expect(2) = 3e-36
 Identities = 65/118 (55%), Positives = 83/118 (70%)
 Frame = +2

Query: 23  MGVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPP 202
           MG+D+R + +R   R+ PKS ++YL+LLVKLYRFLARRT+SAFNKVVL+RLFMSR NRPP
Sbjct: 1   MGIDLRKHHERSTHRKAPKSDNVYLKLLVKLYRFLARRTDSAFNKVVLRRLFMSRINRPP 60

Query: 203 LALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           +++SR++  +K  G E KT           R+  VPK+ V ALR T  AR RI  AGG
Sbjct: 61  MSISRIVANLK--GNEKKTVVVVGTVTDDNRLLTVPKVSVAALRFTATARARIEAAGG 116



 Score = 45.4 bits (106), Expect(2) = 3e-36
 Identities = 29/77 (37%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +3

Query: 366 ARGGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARN---APTDTPRPYVRSK 536
           A GG  +T DQ          ++  +R  + A      RE  ++    P    +PYV SK
Sbjct: 113 AAGGQAITLDQLALE-KPTGANTLLLRGPKNA------REAVKHFGFGPHKHKKPYVASK 165

Query: 537 GRKFERARGRRASRGYK 587
           GRKFE+ARGRR S+G+K
Sbjct: 166 GRKFEKARGRRRSKGFK 182


>Q801I8 (Q801I8) Ribosomal protein L18 (Fragment)
          Length = 165

 Score =  151 bits (382), Expect = 5e-36
 Identities = 87/154 (56%), Positives = 99/154 (63%)
 Frame = +2

Query: 56  KVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPLALSRMIRKMK 235
           KVRR+EPKSQDIYLRLLVKLYRFLARR+  A NKVVLKRLF SRTNRPPL+L+R+IRKM+
Sbjct: 1   KVRRKEPKSQDIYLRLLVKLYRFLARRSPGALNKVVLKRLFTSRTNRPPLSLARLIRKMR 60

Query: 236 LPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGGVGPHLRPIWPWLL 415
           +PGRE KTA          R  +VPKLKVCALRVT  AR RIL+AGG       +     
Sbjct: 61  MPGREGKTAVVVGAIMDDVRTFDVPKLKVCALRVTDVARHRILKAGGQIMTFDQL-ALAS 119

Query: 416 PKGRAQXXXXXXXXXXXXXXTSGRRPERPNRHTK 517
           PKG+                  G  P  P+ HTK
Sbjct: 120 PKGQGTVLLSGPRKGREVYRHFGPAPGAPHSHTK 153


>Q8TFH1 (Q8TFH1) 60S ribosomal protein L18
          Length = 187

 Score =  122 bits (307), Expect(2) = 2e-35
 Identities = 63/120 (52%), Positives = 82/120 (67%), Gaps = 2/120 (1%)
 Frame = +2

Query: 23  MGVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPP 202
           MG+DI  +  RK +R +P S+++YL+LLVKLYRFLARRT+S FNK +LKRLF S+TNRPP
Sbjct: 1   MGIDIERHHVRKSQRSKPASENVYLKLLVKLYRFLARRTDSRFNKAILKRLFQSKTNRPP 60

Query: 203 LALSRM--IRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           +++S++  +   K    E KT           R+  VPKL V ALR TK AR RIL+AGG
Sbjct: 61  ISISKIAALTSRKSASLEGKTTVIVGTVTDDERLLTVPKLSVAALRFTKSARARILKAGG 120



 Score = 48.5 bits (114), Expect(2) = 2e-35
 Identities = 35/80 (43%), Positives = 40/80 (49%), Gaps = 8/80 (10%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*-----GVSALREGARN---APTDTPRPYV 527
           GG VLT DQ             A+RA  G+      G    RE  R+    P     PYV
Sbjct: 119 GGEVLTLDQL------------ALRAPTGSNTVLLRGKKHAREAYRHFGFGPHKHKAPYV 166

Query: 528 RSKGRKFERARGRRASRGYK 587
           RS+GRKFERARGRR SR +K
Sbjct: 167 RSEGRKFERARGRRKSRAFK 186


>BAC83538 (BAC83538) Putative cytoplasmic ribosomal protein
          Length = 195

 Score =  119 bits (299), Expect(2) = 2e-35
 Identities = 64/125 (51%), Positives = 86/125 (68%), Gaps = 7/125 (5%)
 Frame = +2

Query: 23  MGVD-IRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRP 199
           MG+D +   R++K +R  P+S+D+YL+L+VKLYRFL RRT S FN V+LKRLFMS+TNRP
Sbjct: 1   MGIDLVAGGRNKKTKRTAPRSEDVYLKLIVKLYRFLVRRTKSHFNAVILKRLFMSKTNRP 60

Query: 200 PLALSRMIRKM--KLPGRE----NKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRI 361
           PL++ R++R M  K+P R     ++ A          RI EVP +KV ALR T+ AR RI
Sbjct: 61  PLSMRRLVRFMEGKVPDRHAISGDQIAVIVGTVTDDKRIYEVPAMKVAALRFTETARARI 120

Query: 362 LRAGG 376
           + AGG
Sbjct: 121 INAGG 125



 Score = 51.2 bits (121), Expect(2) = 2e-35
 Identities = 30/72 (41%), Positives = 39/72 (53%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG  LTFDQ        + ++  +R  + A         A   P    +PYVRSKGRKFE
Sbjct: 124 GGECLTFDQLALRAPLGQ-NTVLLRGPKNAREAVKHFGPAPGVPHSNTKPYVRSKGRKFE 182

Query: 552 RARGRRASRGYK 587
           +ARGRR S+G+K
Sbjct: 183 KARGRRNSKGFK 194


>RL18_SCHPO (Q10192) 60S ribosomal protein L18
          Length = 187

 Score =  122 bits (306), Expect(2) = 2e-35
 Identities = 61/120 (50%), Positives = 83/120 (68%), Gaps = 2/120 (1%)
 Frame = +2

Query: 23  MGVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPP 202
           MG+DI  +  +K +R +P S+++YL+LLVKLYRFLARRT+S FNK +LKRLF S+TNRPP
Sbjct: 1   MGIDIERHHVKKSQRSKPASENVYLKLLVKLYRFLARRTDSRFNKAILKRLFQSKTNRPP 60

Query: 203 LALSRM--IRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           +++S++  +   K    +NKT           R+  VPKL + ALR TK AR RIL+AGG
Sbjct: 61  ISISKIAALTSRKSASSQNKTTVVVGTVTDDERMLTVPKLSIAALRFTKSARARILKAGG 120



 Score = 48.5 bits (114), Expect(2) = 2e-35
 Identities = 33/75 (44%), Positives = 41/75 (54%), Gaps = 3/75 (4%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARN---APTDTPRPYVRSKGR 542
           GG VLT DQ     +    ++  VR ++ A      RE  R+    P     PYVRS+GR
Sbjct: 119 GGEVLTLDQLALR-APTGSNTVLVRGKKHA------REAYRHFGFGPHKHKAPYVRSEGR 171

Query: 543 KFERARGRRASRGYK 587
           KFERARGRR SR +K
Sbjct: 172 KFERARGRRKSRAFK 186


>RL18_SALSA (P24558) 60S ribosomal protein L18
          Length = 179

 Score =  128 bits (321), Expect(2) = 5e-35
 Identities = 67/116 (57%), Positives = 88/116 (75%), Gaps = 1/116 (0%)
 Frame = +2

Query: 23  MGVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSA-FNKVVLKRLFMSRTNRP 199
           MG+ I+HN+DR VR ++P S+DI   LLVK+YR    + ++A FNKVVL+RLFMSRT+RP
Sbjct: 1   MGIVIQHNKDRLVRPKQPLSEDI--TLLVKIYRLPGSKCSTAPFNKVVLRRLFMSRTHRP 58

Query: 200 PLALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILR 367
           P+++SRMIRKMKLPGREN+TA          RI E+P LKV AL++T+  RTRIL+
Sbjct: 59  PMSVSRMIRKMKLPGRENRTAVVVGTVTDDVRIHEIPNLKVSALKITRRNRTRILK 114



 Score = 41.6 bits (96), Expect(2) = 5e-35
 Identities = 19/34 (55%), Positives = 23/34 (66%)
 Frame = +1

Query: 400 LAMAAPKGKGTVLLSGPRKGREVYRHFGKAPGTP 501
           LA+AAP  + +VLLS PR  R+V RHF  AP  P
Sbjct: 124 LALAAPNRQKSVLLSAPRNARDVSRHFANAPSIP 157


>RL18_CICAR (O65729) 60S ribosomal protein L18 (Fragment)
          Length = 183

 Score =  118 bits (296), Expect(2) = 1e-34
 Identities = 60/110 (54%), Positives = 79/110 (71%)
 Frame = +2

Query: 47  RDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPLALSRMIR 226
           +++K +R  PKS DIYL+LLVKLYRFL RRT+S FN V+LKRLFMS+ NRPPL+LSR+I+
Sbjct: 7   KNKKTKRTSPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNRPPLSLSRLIK 66

Query: 227 KMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
            M+  G+E K            R+ +VP +KV AL+ T+ AR RI +AGG
Sbjct: 67  YMQ--GKEGKIGVVVGAVTDDIRVYDVPTIKVTALKFTETARARIQKAGG 114



 Score = 50.1 bits (118), Expect(2) = 1e-34
 Identities = 30/72 (41%), Positives = 38/72 (52%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG  LTFDQ        +  +  +R  + A         A   P    +PYVRSKGRKFE
Sbjct: 113 GGECLTFDQLALRLPLTD--TVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFE 170

Query: 552 RARGRRASRGYK 587
           +ARGRR SRG++
Sbjct: 171 KARGRRKSRGFR 182


>RL18_ARATH (P42791) 60S ribosomal protein L18
          Length = 187

 Score =  118 bits (295), Expect(2) = 4e-34
 Identities = 62/119 (52%), Positives = 81/119 (67%), Gaps = 1/119 (0%)
 Frame = +2

Query: 23  MGVD-IRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRP 199
           MG+D I   + +K +R  PKS D+YL+L VKLYRFL RRTNS FN V+LKRLFMS+ N+ 
Sbjct: 1   MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNKA 60

Query: 200 PLALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           PL+LSR++  M   G+E+K A          R+ E+P +KV ALR T+ AR RI +AGG
Sbjct: 61  PLSLSRLVEFM--TGKEDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGG 117



 Score = 48.5 bits (114), Expect(2) = 4e-34
 Identities = 28/72 (38%), Positives = 39/72 (53%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG  LTFDQ        + ++  +R  + +         A   P    +PYVR+KGRKFE
Sbjct: 116 GGECLTFDQLALRAPLGQ-NTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFE 174

Query: 552 RARGRRASRGYK 587
           +ARG+R SRG+K
Sbjct: 175 KARGKRKSRGFK 186



 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 22/41 (53%), Positives = 27/41 (65%)
 Frame = +1

Query: 400 LAMAAPKGKGTVLLSGPRKGREVYRHFGKAPGTPQQTHQDP 522
           LA+ AP G+ TVLL GP+  RE  +HFG APG P  +H  P
Sbjct: 125 LALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVP-HSHSKP 164


>Q940B0 (Q940B0) Putative 60S ribosomal protein
          Length = 187

 Score =  117 bits (293), Expect(2) = 7e-34
 Identities = 61/119 (51%), Positives = 82/119 (68%), Gaps = 1/119 (0%)
 Frame = +2

Query: 23  MGVD-IRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRP 199
           MG+D I   + +K +R  PKS D+YL+LLVKLYRFL RR+NS FN V+LKRLFMS+ N+ 
Sbjct: 1   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSNSNFNAVILKRLFMSKVNKA 60

Query: 200 PLALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           PL+LSR++  M   G+++K A          R+ E+P +KV ALR T+ AR RI +AGG
Sbjct: 61  PLSLSRLVEFM--TGKDDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGG 117



 Score = 48.5 bits (114), Expect(2) = 7e-34
 Identities = 28/72 (38%), Positives = 38/72 (51%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG  LTFDQ        + ++  +R  + +         A   P    +PYVR KGRKFE
Sbjct: 116 GGECLTFDQLALRAPLGQ-NTVLLRGPKNSREAVKHFGPAPGVPHSNTKPYVRHKGRKFE 174

Query: 552 RARGRRASRGYK 587
           +ARG+R SRG+K
Sbjct: 175 KARGKRKSRGFK 186



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 20/34 (58%), Positives = 24/34 (69%)
 Frame = +1

Query: 400 LAMAAPKGKGTVLLSGPRKGREVYRHFGKAPGTP 501
           LA+ AP G+ TVLL GP+  RE  +HFG APG P
Sbjct: 125 LALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVP 158


>RL18_YEAST (P07279) 60S ribosomal protein L18 (RP28)
          Length = 186

 Score =  115 bits (287), Expect(2) = 1e-31
 Identities = 61/119 (51%), Positives = 77/119 (64%), Gaps = 1/119 (0%)
 Frame = +2

Query: 23  MGVD-IRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRP 199
           MG+D       R   R  PKS ++YL+LLVKLY FLARRT++ FNKVVLK LF+S+ NRP
Sbjct: 1   MGIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKALFLSKINRP 60

Query: 200 PLALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           P+++SR+ R +K  G  NKT           RI E PK  V ALR T GAR +I++AGG
Sbjct: 61  PVSVSRIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTVAALRFTAGARAKIVKAGG 119



 Score = 43.1 bits (100), Expect(2) = 1e-31
 Identities = 18/31 (58%), Positives = 22/31 (70%)
 Frame = +1

Query: 400 LAMAAPKGKGTVLLSGPRKGREVYRHFGKAP 492
           LA+ APKG+ T++L GPR  RE  RHFG  P
Sbjct: 127 LAVRAPKGQNTLILRGPRNSREAVRHFGMGP 157


>Q86LY7 (Q86LY7) Ribosomal protein L18 (Fragment)
          Length = 159

 Score =  132 bits (331), Expect = 4e-30
 Identities = 74/151 (49%), Positives = 91/151 (60%)
 Frame = +2

Query: 65  RREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPLALSRMIRKMKLPG 244
           R+EPKSQDIYLRLLVKLYRFLARRT S FN++VLKRLFMSR +RPP++++R++R+MK  G
Sbjct: 1   RKEPKSQDIYLRLLVKLYRFLARRTRSRFNQIVLKRLFMSRMHRPPVSIARIMRQMKKHG 60

Query: 245 RENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGGVGPHLRPIWPWLLPKG 424
           RE  T           R+ +VPKLKVCALR T   R RI  AGG+      +   L P G
Sbjct: 61  REGLTCVTVGSVTNDSRVLKVPKLKVCALRFTAKVRERIEAAGGLRQTFDQL-ALLAPTG 119

Query: 425 RAQXXXXXXXXXXXXXXTSGRRPERPNRHTK 517
           +                  GR P  P+ H K
Sbjct: 120 KRTVLIQGPRKSRKACRHFGRAPGVPHSHAK 150


>EAA20707 (EAA20707) Eukaryotic ribosomal protein L18, putat
          Length = 243

 Score = 95.5 bits (236), Expect(2) = 3e-29
 Identities = 56/126 (44%), Positives = 77/126 (60%), Gaps = 1/126 (0%)
 Frame = +2

Query: 2   FRSHRCRMGVDIRH-NRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLF 178
           F S    MG+D+++  R +K  R+   S++ YLRLLVKLYRFLARRT+  FNK++ KRL 
Sbjct: 50  FSSILINMGIDLKNVGRIKKHGRKNLVSKNPYLRLLVKLYRFLARRTDVNFNKIIAKRLI 109

Query: 179 MSRTNRPPLALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTR 358
           M +  RPPL+LS++ + M     +N  A          R+     +KVCALR T+ AR R
Sbjct: 110 MPKRFRPPLSLSKLQQHMS--NNQNSVAVVVGSITDDKRLFSCRNMKVCALRFTETARKR 167

Query: 359 ILRAGG 376
           I+ AGG
Sbjct: 168 IVDAGG 173



 Score = 54.7 bits (130), Expect(2) = 3e-29
 Identities = 35/78 (44%), Positives = 39/78 (49%), Gaps = 6/78 (7%)
 Frame = +3

Query: 372 GGSVLTFDQF------GHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRS 533
           GG  LTFDQ       G  C    G + A  A++           A   P    RPYVRS
Sbjct: 172 GGECLTFDQLALRYPTGKDCILLRGPTKARTAEKHF-------GSAPGRPKSKARPYVRS 224

Query: 534 KGRKFERARGRRASRGYK 587
           KGRKFE+ARGRR SR YK
Sbjct: 225 KGRKFEKARGRRKSRAYK 242


>O45946 (O45946) Y45F10D.12 protein
          Length = 188

 Score =  128 bits (321), Expect = 6e-29
 Identities = 75/165 (45%), Positives = 90/165 (54%)
 Frame = +2

Query: 23  MGVDIRHNRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPP 202
           MG+DI H  DR  RR  PKS++ YLRLL KLY FLARRT   FN +VLKRL MSR NR P
Sbjct: 1   MGIDINHKHDRVARRTAPKSENPYLRLLSKLYAFLARRTGEKFNAIVLKRLRMSRRNRQP 60

Query: 203 LALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGGVG 382
           L+L+++ R ++  G ENKT           R+  VPK+ V AL VT+GAR RIL AGG  
Sbjct: 61  LSLAKLARAVQKAGNENKTVVTLSTVTDDARLYTVPKISVAALHVTEGARARILAAGGEI 120

Query: 383 PHLRPIWPWLLPKGRAQXXXXXXXXXXXXXXTSGRRPERPNRHTK 517
             L  +     PKG                   G  P  P+ HTK
Sbjct: 121 ITLDQL-ALKSPKGENTVFLQGPRSAREAEKHFGPAPGVPHSHTK 164



 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 33/75 (44%), Positives = 41/75 (54%)
 Frame = +3

Query: 366 ARGGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRK 545
           A GG ++T DQ      + E ++  ++    A         A   P    +PYVRSKGRK
Sbjct: 115 AAGGEIITLDQLALKSPKGE-NTVFLQGPRSAREAEKHFGPAPGVPHSHTKPYVRSKGRK 173

Query: 546 FERARGRRASRGYKN 590
           FERARGRRASR YKN
Sbjct: 174 FERARGRRASRAYKN 188


>Q8IDS5 (Q8IDS5) 60S ribosomal subunit porotein L18, putativ
          Length = 193

 Score = 89.0 bits (219), Expect(2) = 7e-27
 Identities = 51/110 (46%), Positives = 68/110 (61%)
 Frame = +2

Query: 47  RDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPLALSRMIR 226
           R +K  R+   S++ YLRLLVKLY FLARRTN+ FNK++ KRL M +  RPPL+LS++  
Sbjct: 16  RIKKHGRKHLVSKNPYLRLLVKLYNFLARRTNANFNKIIAKRLIMPKRYRPPLSLSKL-- 73

Query: 227 KMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           +  +    N  A          R+  + +LKVCALR T+ AR RI  AGG
Sbjct: 74  QYHMANHPNDIAVVVGSITDDKRLFSLKQLKVCALRFTETARKRIEDAGG 123



 Score = 53.5 bits (127), Expect(2) = 7e-27
 Identities = 35/78 (44%), Positives = 39/78 (49%), Gaps = 6/78 (7%)
 Frame = +3

Query: 372 GGSVLTFDQF------GHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRS 533
           GG  LTFDQ       G  C    G + A  A++           A   P    RPYVRS
Sbjct: 122 GGECLTFDQLALKYPTGKKCVLLRGPTKARTAEKHF-------GKAPGKPKSKARPYVRS 174

Query: 534 KGRKFERARGRRASRGYK 587
           KGRKFE+ARGRR SR YK
Sbjct: 175 KGRKFEKARGRRKSRAYK 192


>RL18_TRYBB (P50885) 60S ribosomal protein L18
          Length = 193

 Score = 90.9 bits (224), Expect(2) = 6e-24
 Identities = 51/125 (40%), Positives = 75/125 (59%), Gaps = 7/125 (5%)
 Frame = +2

Query: 23  MGVDIRH-NRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRP 199
           MGVD+    + ++V R    S + Y++LL+KLY+FL +RTNS FNK++ KRL  SR NR 
Sbjct: 1   MGVDLTGVQKKKRVVRHHTYSTNPYIKLLIKLYKFLGKRTNSPFNKLIHKRLLKSRNNRA 60

Query: 200 PLALSRMIRKMK------LPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRI 361
           P++LSR+   M+        G+++  A          R+  +P L++CALR +K AR RI
Sbjct: 61  PISLSRIAVCMRRRTVWLKKGKKSPIAVIVGDVLDDVRMTRIPALRICALRFSKSARERI 120

Query: 362 LRAGG 376
             AGG
Sbjct: 121 TGAGG 125



 Score = 41.6 bits (96), Expect(2) = 6e-24
 Identities = 21/40 (52%), Positives = 26/40 (64%), Gaps = 2/40 (5%)
 Frame = +1

Query: 400 LAMAAPKGKGTVLLSGPRKGREVYRHFGKA--PGTPQQTH 513
           LAM AP GK T+LL G + GRE  +HFG A  PG+  + H
Sbjct: 133 LAMMAPTGKNTMLLRGRKSGRESVKHFGAAGVPGSHAKPH 172


>Q9U5R6 (Q9U5R6) Putative ribosomal protein L18 (Fragment)
          Length = 169

 Score = 77.0 bits (188), Expect(2) = 4e-23
 Identities = 46/100 (46%), Positives = 62/100 (62%), Gaps = 7/100 (7%)
 Frame = +2

Query: 98  RLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPLALSRMI----RKMKLPGRE---NK 256
           RLLVKLY+FL+RRT ++FNK VLKRL  SR NR P++LS++     RK  +  +E   + 
Sbjct: 1   RLLVKLYKFLSRRTTASFNKCVLKRLLNSRVNRAPVSLSKLAKYSQRKSYIDQKEKGNDL 60

Query: 257 TAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
                       R+ +VP+LKVCAL+ T+ AR RI  A G
Sbjct: 61  IFAVVGTVTDDTRLIDVPELKVCALKFTEKARERITAAKG 100



 Score = 52.8 bits (125), Expect(2) = 4e-23
 Identities = 35/77 (45%), Positives = 39/77 (50%), Gaps = 2/77 (2%)
 Frame = +3

Query: 363 SARGGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALRE--GARNAPTDTPRPYVRSK 536
           +A  G  +TFDQ      Q E     V    G     A +    A   P    +PYVRSK
Sbjct: 96  TAAKGKCITFDQLAINRPQGEN----VILLRGTRDREAKKHFGKAPGLPDSNTKPYVRSK 151

Query: 537 GRKFERARGRRASRGYK 587
           GRKFERARGRR SRGYK
Sbjct: 152 GRKFERARGRRRSRGYK 168


>Q9GRJ5 (Q9GRJ5) Ribosomal protein L18
          Length = 198

 Score = 87.4 bits (215), Expect(2) = 1e-22
 Identities = 51/125 (40%), Positives = 74/125 (58%), Gaps = 7/125 (5%)
 Frame = +2

Query: 23  MGVDIRH-NRDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRP 199
           MGVD+   ++  +V R    S + Y++LL+KLY+FLA+RT+S FNKVV +RL  SR+NR 
Sbjct: 1   MGVDLTGISKKSRVIRHHTYSTNPYIKLLIKLYKFLAKRTSSGFNKVVYQRLIKSRSNRA 60

Query: 200 PLALSRMIRKMK------LPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRI 361
           P++LSR+   MK         +    A          R+  +P ++VCALR +K AR  I
Sbjct: 61  PISLSRIAVVMKRKAVFTAKSKAAPIAVVVGDVLDDVRMARIPAMRVCALRFSKSARQSI 120

Query: 362 LRAGG 376
           + AGG
Sbjct: 121 VAAGG 125



 Score = 40.4 bits (93), Expect(2) = 1e-22
 Identities = 23/41 (56%), Positives = 25/41 (60%)
 Frame = +1

Query: 400 LAMAAPKGKGTVLLSGPRKGREVYRHFGKAPGTPQQTHQDP 522
           LAM AP GK T LL G + GRE  RHFG A G P  +H  P
Sbjct: 133 LAMIAPTGKNTYLLRGRKSGRESVRHFG-ASGVP-GSHSKP 171


>Q8UW20 (Q8UW20) Ribosomal protein L14 (Fragment)
          Length = 134

 Score = 97.1 bits (240), Expect = 2e-19
 Identities = 54/111 (48%), Positives = 65/111 (57%)
 Frame = +2

Query: 185 RTNRPPLALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRIL 364
           RTNRPPL++SR+IRKMKL GRENKTA          RIQE+PKLK+CALRVT+GAR RIL
Sbjct: 1   RTNRPPLSVSRLIRKMKLEGRENKTAVVVGTVTDDVRIQEIPKLKICALRVTQGARRRIL 60

Query: 365 RAGGVGPHLRPIWPWLLPKGRAQXXXXXXXXXXXXXXTSGRRPERPNRHTK 517
           +AGG       +     PKG+                  G+ P  P+ HTK
Sbjct: 61  KAGGQIMTFDQL-AMAAPKGQGTVLLSGPRKARQVYRHFGKAPGTPHSHTK 110



 Score = 62.0 bits (149), Expect = 6e-09
 Identities = 35/73 (47%), Positives = 42/73 (56%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG ++TFDQ      + +G +  +     A  V      A   P    +PYVRSKGRKFE
Sbjct: 63  GGQIMTFDQLAMAAPKGQG-TVLLSGPRKARQVYRHFGKAPGTPHSHTKPYVRSKGRKFE 121

Query: 552 RARGRRASRGYKN 590
           RARGRRASRGYKN
Sbjct: 122 RARGRRASRGYKN 134


>EAA37305 (EAA37305) GLP_66_20117_19578
          Length = 179

 Score = 87.8 bits (216), Expect(2) = 2e-18
 Identities = 47/119 (39%), Positives = 73/119 (60%), Gaps = 1/119 (0%)
 Frame = +2

Query: 23  MGVDIRHN-RDRKVRRREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRP 199
           MG+D++   + RKV R+EPKS + Y+RLL   ++ +   T   F KV+ KRL +S+TNRP
Sbjct: 1   MGIDLKTGIKKRKVERKEPKSPNPYIRLLHNAFKVVYENTGEDFTKVLTKRLCLSKTNRP 60

Query: 200 PLALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
            L++SR+   M    RE+K A          R+  +P++ +CAL+ +  AR+RI +AGG
Sbjct: 61  VLSVSRLAHLMH--KREDKIAVVASTVTNDERLVTIPRMTICALKFSATARSRIEKAGG 117



 Score = 26.2 bits (56), Expect(2) = 2e-18
 Identities = 16/36 (44%), Positives = 19/36 (52%)
 Frame = +1

Query: 415 PKGKGTVLLSGPRKGREVYRHFGKAPGTPQQTHQDP 522
           P G   VLL G R  R V + FG +PG P  +H  P
Sbjct: 130 PTGDNCVLLQGRRSCRAVCKKFG-SPGRP-NSHVKP 163


>Q8T6A0 (Q8T6A0) 60S ribosomal protein L18
          Length = 120

 Score = 55.1 bits (131), Expect(2) = 4e-16
 Identities = 28/49 (57%), Positives = 32/49 (65%)
 Frame = +2

Query: 230 MKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
           MK  GRENK A          RI  +PKLKVCALR+T+ AR RIL+AGG
Sbjct: 2   MKKDGRENKIAVIVGAITDDIRIHNLPKLKVCALRITERARGRILKAGG 50



 Score = 51.2 bits (121), Expect(2) = 4e-16
 Identities = 24/41 (58%), Positives = 29/41 (70%)
 Frame = +1

Query: 400 LAMAAPKGKGTVLLSGPRKGREVYRHFGKAPGTPQQTHQDP 522
           LA+ APKG+ TVL+ G RK R+ YRHFG APG P  +H  P
Sbjct: 58  LALRAPKGQNTVLVQGGRKARKAYRHFGLAPGVP-HSHTAP 97



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 33/74 (44%), Positives = 37/74 (49%), Gaps = 2/74 (2%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREG--ARNAPTDTPRPYVRSKGRK 545
           GG ++TFDQ      + +     V  Q G     A R    A   P     P VRSKGRK
Sbjct: 49  GGEIITFDQLALRAPKGQN---TVLVQGGRKARKAYRHFGLAPGVPHSHTAPIVRSKGRK 105

Query: 546 FERARGRRASRGYK 587
           FERARG R SRGYK
Sbjct: 106 FERARGPRKSRGYK 119


>O22254 (O22254) 60S ribosomal protein L18, 5'partial (Fragm
          Length = 135

 Score = 55.5 bits (132), Expect(2) = 3e-15
 Identities = 30/66 (45%), Positives = 41/66 (61%)
 Frame = +2

Query: 179 MSRTNRPPLALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTR 358
           MS+ N+ PL+LSR++R M   G++ K A          RI++VP L V ALR T+ AR R
Sbjct: 1   MSKVNKAPLSLSRLVRYMD--GKDGKIAVIVGTVTDDVRIEDVPALTVTALRFTESARAR 58

Query: 359 ILRAGG 376
           I +AGG
Sbjct: 59  IHKAGG 64



 Score = 47.8 bits (112), Expect(2) = 3e-15
 Identities = 27/72 (37%), Positives = 34/72 (46%)
 Frame = +3

Query: 372 GGSVLTFDQFGHGCSQREGHSAAVRAQEGA*GVSALREGARNAPTDTPRPYVRSKGRKFE 551
           GG  LTFDQ    C     ++  +R  +           A   P    +PYVR  G+K E
Sbjct: 63  GGECLTFDQLALPCPTWSENTVLLRGPKNTREAVKHFGPAPGVPHSHTKPYVRQTGKKIE 122

Query: 552 RARGRRASRGYK 587
            ARGRR SRG+K
Sbjct: 123 IARGRRRSRGFK 134


>AAQ56708 (AAQ56708) Ribosomal protein L18-like (Fragment)
          Length = 31

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 29/31 (93%), Positives = 31/31 (99%)
 Frame = +2

Query: 23  MGVDIRHNRDRKVRRREPKSQDIYLRLLVKL 115
           MGVDIRHN+DRKVRR+EPKSQDIYLRLLVKL
Sbjct: 1   MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKL 31


>Q9BML2 (Q9BML2) Putative ribosomal protein (Fragment)
          Length = 133

 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 39/107 (36%), Positives = 52/107 (48%)
 Frame = +2

Query: 194 RPPLALSRMIRKMKLPGRENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAG 373
           R  ++L+R++R M   GRE KTA          RI ++PKLK+CALRVT  AR RI++AG
Sbjct: 3   RTAMSLARVVRFMNKDGREGKTAVVVGCITDDVRIHKLPKLKICALRVTARARARIIKAG 62

Query: 374 GVGPHLRPIWPWLLPKGRAQXXXXXXXXXXXXXXTSGRRPERPNRHT 514
           G       +     PKG+                  GR P  P+ HT
Sbjct: 63  GEIITFDQL-ALQSPKGQNTVLMQGCRTHRKVYRHFGRAPGTPSAHT 108


>Q8SS76 (Q8SS76) 60S ribosomal protein L18
          Length = 200

 Score = 58.9 bits (141), Expect = 5e-08
 Identities = 33/104 (31%), Positives = 60/104 (56%)
 Frame = +2

Query: 65  RREPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPLALSRMIRKMKLPG 244
           R+EP+S++IYLR L   Y  +A  ++    K + KRL MS+++R P+ +S+++   ++  
Sbjct: 20  RKEPRSKNIYLRALSDFYTKVASNSSVLAIKKISKRLKMSKSDRQPVKISKIV--SEIGE 77

Query: 245 RENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
            ++K A           +  +P +KV AL+ +KG + +I R GG
Sbjct: 78  SKDKVAVVVAKVLDDDEVMVIPAVKVVALQWSKGVKEKIERYGG 121


>Q98RU3 (Q98RU3) 60s ribosomal protein L18
          Length = 167

 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 31/103 (30%), Positives = 49/103 (47%)
 Frame = +2

Query: 68  REPKSQDIYLRLLVKLYRFLARRTNSAFNKVVLKRLFMSRTNRPPLALSRMIRKMKLPGR 247
           +  KS D+YLR  VK  +         F K +++R   SR +R  ++LS++I K  L   
Sbjct: 41  KSTKSTDLYLRTFVKNLKLPRENVKKKFLKELIRRTNSSRKSRSVISLSKLI-KFSLKDT 99

Query: 248 ENKTAXXXXXXXXXXRIQEVPKLKVCALRVTKGARTRILRAGG 376
             K+           RI + PKLK+ AL  +   + +I+  GG
Sbjct: 100 -TKSILTVSKILNDERISKTPKLKIFALNFSSSVKKKIIENGG 141


  Database: sp_tr_nrdb
    Posted date:  Sep 24, 2003  2:13 PM
  Number of letters in database: 406,886,216
  Number of sequences in database:  1,272,877
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 483,800,104
Number of Sequences: 1272877
Number of extensions: 11014899
Number of successful extensions: 36908
Number of sequences better than 1.0e-03: 88
Number of HSP's better than  0.0 without gapping: 32960
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36520
length of database: 406,886,216
effective HSP length: 117
effective length of database: 257,959,607
effective search space used: 23216364630
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)