BLASTX 2.2.3 [Apr-24-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 603107410F1
         (830 letters)

Database: sp_tr_nrdb 
           1,272,877 sequences; 406,886,216 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q96FH0 (Q96FH0) Similar to RIKEN cDNA 2310045N01 gene                 169   5e-41
Q9D6Y4 (Q9D6Y4) 2310045N01Rik protein                                 165   6e-40
Q9BWB3 (Q9BWB3) Hypothetical protein (Fragment)                       163   2e-39
Q9BT01 (Q9BT01) Similar to RIKEN cDNA 2310045N01 gene                 163   2e-39
EAA10220 (EAA10220) AgCP15219 (Fragment)                               92   1e-17
Q8IR45 (Q8IR45) CG32590-PA                                             77   3e-13
O45685 (O45685) K11B4.2 protein                                        60   3e-08

>Q96FH0 (Q96FH0) Similar to RIKEN cDNA 2310045N01 gene
          Length = 119

 Score =  169 bits (427), Expect = 5e-41
 Identities = 85/114 (74%), Positives = 99/114 (86%), Gaps = 1/114 (0%)
 Frame = +3

Query: 3   KVKKVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVE 182
           K KKVTDKFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQSQGAIYTVE
Sbjct: 9   KGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVE 68

Query: 183 YACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNA-AQGRSAVAPQAKNPPGSS 341
           YACSA+K++ DSSVYF+S++ LLK AI+++D +NA AQG S   P+   PP S+
Sbjct: 69  YACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHS---PEEPPPPSSA 119


>Q9D6Y4 (Q9D6Y4) 2310045N01Rik protein
          Length = 120

 Score =  165 bits (418), Expect = 6e-40
 Identities = 84/113 (74%), Positives = 98/113 (86%), Gaps = 1/113 (0%)
 Frame = +3

Query: 3   KVKKVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVE 182
           K KKVTDKFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQSQGAIYTVE
Sbjct: 9   KGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVE 68

Query: 183 YACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLN-AAQGRSAVAPQAKNPPGS 338
           YACSA+KS+ DSSVYF+S++ LLK AI+++D +N +AQG S    +  +PP S
Sbjct: 69  YACSAVKSLVDSSVYFRSVEGLLKQAISIRDHMNTSAQGHS---QEKLSPPPS 118


>Q9BWB3 (Q9BWB3) Hypothetical protein (Fragment)
          Length = 119

 Score =  163 bits (413), Expect = 2e-39
 Identities = 80/99 (80%), Positives = 92/99 (92%), Gaps = 1/99 (1%)
 Frame = +3

Query: 3   KVKKVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVE 182
           K KKVTDKFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQSQGAIYTVE
Sbjct: 19  KGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVE 78

Query: 183 YACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNA-AQG 296
           YACSA+K++ DSSVYF+S++ LLK AI+++D +NA AQG
Sbjct: 79  YACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQG 117


>Q9BT01 (Q9BT01) Similar to RIKEN cDNA 2310045N01 gene
          Length = 109

 Score =  163 bits (413), Expect = 2e-39
 Identities = 80/99 (80%), Positives = 92/99 (92%), Gaps = 1/99 (1%)
 Frame = +3

Query: 3   KVKKVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVE 182
           K KKVTDKFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQSQGAIYTVE
Sbjct: 9   KGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVE 68

Query: 183 YACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNA-AQG 296
           YACSA+K++ DSSVYF+S++ LLK AI+++D +NA AQG
Sbjct: 69  YACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQG 107


>EAA10220 (EAA10220) AgCP15219 (Fragment)
          Length = 196

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 40/99 (40%), Positives = 67/99 (67%)
 Frame = +3

Query: 3   KVKKVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVE 182
           KVKK T+K +E+M+++ANEPS+A YR+QEHVR+ +P + + ++++   ++  QG  Y +E
Sbjct: 27  KVKKTTEKISENMHIIANEPSLAFYRIQEHVRKVIPLIVERRAEVVQLQQDLQGKCYDME 86

Query: 183 YACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNAAQGR 299
           YA  A+K +  +    K++  LLK+AI +K QL   + R
Sbjct: 87  YAIGAVKDIEAADTSLKNVQELLKNAIFLKQQLKYVESR 125


>Q8IR45 (Q8IR45) CG32590-PA
          Length = 183

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 36/121 (29%), Positives = 68/121 (55%)
 Frame = +3

Query: 3   KVKKVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVE 182
           K KK ++K +E++++ AN+PS+A +R+QEHVR+  P + + + ++   +   QG  Y +E
Sbjct: 10  KAKKTSEKISENIHIFANDPSLAFFRVQEHVRKVTPAIFEKRDEVFQLQNNLQGHCYDME 69

Query: 183 YACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNAAQGRSAVAPQAKNPPGSS*FQTRLA 362
           Y   A++++  S   F++I  ++K +I +K QL   + R  V   +        F   LA
Sbjct: 70  YGIQALRTIEKSESIFENIQEMIKASIFLKQQLKYEESRKKVKKDSTKSSVYKRFSAHLA 129

Query: 363 V 365
           +
Sbjct: 130 L 130


>O45685 (O45685) K11B4.2 protein
          Length = 151

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 34/99 (34%), Positives = 54/99 (54%)
 Frame = +3

Query: 15  VTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEYACS 194
           ++++  ES+ +L NEPS+ALYRLQEH  RSLP L   +  +        GA + +E   S
Sbjct: 21  ISERICESVRLLDNEPSLALYRLQEHTVRSLPGLVNRRIMLTQQSATLSGAQFDLENTLS 80

Query: 195 AIKSMTDSSVYFKSIDSLLKHAIAMKDQLNAAQGRSAVA 311
              SM +++  F +   LL++ +  K QL+    R A +
Sbjct: 81  TTTSMQNATSAFDNCIELLRNCMFYKQQLDFDSTRKATS 119


  Database: sp_tr_nrdb
    Posted date:  Sep 24, 2003  2:13 PM
  Number of letters in database: 406,886,216
  Number of sequences in database:  1,272,877
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 683,560,830
Number of Sequences: 1272877
Number of extensions: 15582852
Number of successful extensions: 52133
Number of sequences better than 1.0e-03: 14
Number of HSP's better than  0.0 without gapping: 48953
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 52072
length of database: 406,886,216
effective HSP length: 121
effective length of database: 252,868,099
effective search space used: 39194555345
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)