BLASTX 2.2.3 [Apr-24-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 603489889F1
         (651 letters)

Database: sp_tr_nrdb 
           1,272,877 sequences; 406,886,216 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q96FH0 (Q96FH0) Similar to RIKEN cDNA 2310045N01 gene                 184   6e-46
Q9D6Y4 (Q9D6Y4) 2310045N01Rik protein                                 181   7e-45
Q9BWB3 (Q9BWB3) Hypothetical protein (Fragment)                       179   3e-44
Q9BT01 (Q9BT01) Similar to RIKEN cDNA 2310045N01 gene                 179   3e-44
EAA10220 (EAA10220) AgCP15219 (Fragment)                              100   3e-20
Q8IR45 (Q8IR45) CG32590-PA                                             79   5e-14
O45685 (O45685) K11B4.2 protein                                        62   5e-09

>Q96FH0 (Q96FH0) Similar to RIKEN cDNA 2310045N01 gene
          Length = 119

 Score =  184 bits (468), Expect = 6e-46
 Identities = 93/122 (76%), Positives = 107/122 (87%), Gaps = 1/122 (0%)
 Frame = +1

Query: 4   MEEPEMQLKVKKVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQS 183
           MEEPEMQLK KKVTDKFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQS
Sbjct: 1   MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQS 60

Query: 184 QGAIYTVEYACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNA-AQGRSAVAPQAKNPPG 360
           QGAIYTVEYACSA+K++ DSSVYF+S++ LLK AI+++D +NA AQG S   P+   PP 
Sbjct: 61  QGAIYTVEYACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHS---PEEPPPPS 117

Query: 361 SS 366
           S+
Sbjct: 118 SA 119


>Q9D6Y4 (Q9D6Y4) 2310045N01Rik protein
          Length = 120

 Score =  181 bits (459), Expect = 7e-45
 Identities = 92/121 (76%), Positives = 106/121 (87%), Gaps = 1/121 (0%)
 Frame = +1

Query: 4   MEEPEMQLKVKKVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQS 183
           MEEPEMQLK KKVTDKFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQS
Sbjct: 1   MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQS 60

Query: 184 QGAIYTVEYACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLN-AAQGRSAVAPQAKNPPG 360
           QGAIYTVEYACSA+KS+ DSSVYF+S++ LLK AI+++D +N +AQG S    +  +PP 
Sbjct: 61  QGAIYTVEYACSAVKSLVDSSVYFRSVEGLLKQAISIRDHMNTSAQGHS---QEKLSPPP 117

Query: 361 S 363
           S
Sbjct: 118 S 118


>Q9BWB3 (Q9BWB3) Hypothetical protein (Fragment)
          Length = 119

 Score =  179 bits (454), Expect = 3e-44
 Identities = 88/107 (82%), Positives = 100/107 (93%), Gaps = 1/107 (0%)
 Frame = +1

Query: 4   MEEPEMQLKVKKVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQS 183
           MEEPEMQLK KKVTDKFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQS
Sbjct: 11  MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQS 70

Query: 184 QGAIYTVEYACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNA-AQG 321
           QGAIYTVEYACSA+K++ DSSVYF+S++ LLK AI+++D +NA AQG
Sbjct: 71  QGAIYTVEYACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQG 117


>Q9BT01 (Q9BT01) Similar to RIKEN cDNA 2310045N01 gene
          Length = 109

 Score =  179 bits (454), Expect = 3e-44
 Identities = 88/107 (82%), Positives = 100/107 (93%), Gaps = 1/107 (0%)
 Frame = +1

Query: 4   MEEPEMQLKVKKVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQS 183
           MEEPEMQLK KKVTDKFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQS
Sbjct: 1   MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQS 60

Query: 184 QGAIYTVEYACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNA-AQG 321
           QGAIYTVEYACSA+K++ DSSVYF+S++ LLK AI+++D +NA AQG
Sbjct: 61  QGAIYTVEYACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQG 107


>EAA10220 (EAA10220) AgCP15219 (Fragment)
          Length = 196

 Score = 99.8 bits (247), Expect = 3e-20
 Identities = 43/107 (40%), Positives = 73/107 (68%)
 Frame = +1

Query: 4   MEEPEMQLKVKKVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQS 183
           + +PE+Q KVKK T+K +E+M+++ANEPS+A YR+QEHVR+ +P + + ++++   ++  
Sbjct: 19  VNDPELQAKVKKTTEKISENMHIIANEPSLAFYRIQEHVRKVIPLIVERRAEVVQLQQDL 78

Query: 184 QGAIYTVEYACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNAAQGR 324
           QG  Y +EYA  A+K +  +    K++  LLK+AI +K QL   + R
Sbjct: 79  QGKCYDMEYAIGAVKDIEAADTSLKNVQELLKNAIFLKQQLKYVESR 125


>Q8IR45 (Q8IR45) CG32590-PA
          Length = 183

 Score = 79.0 bits (193), Expect = 5e-14
 Identities = 37/125 (29%), Positives = 70/125 (55%)
 Frame = +1

Query: 16  EMQLKVKKVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAI 195
           E+  K KK ++K +E++++ AN+PS+A +R+QEHVR+  P + + + ++   +   QG  
Sbjct: 6   ELVFKAKKTSEKISENIHIFANDPSLAFFRVQEHVRKVTPAIFEKRDEVFQLQNNLQGHC 65

Query: 196 YTVEYACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNAAQGRSAVAPQAKNPPGSS*FQ 375
           Y +EY   A++++  S   F++I  ++K +I +K QL   + R  V   +        F 
Sbjct: 66  YDMEYGIQALRTIEKSESIFENIQEMIKASIFLKQQLKYEESRKKVKKDSTKSSVYKRFS 125

Query: 376 TRLAV 390
             LA+
Sbjct: 126 AHLAL 130


>O45685 (O45685) K11B4.2 protein
          Length = 151

 Score = 62.4 bits (150), Expect = 5e-09
 Identities = 35/107 (32%), Positives = 59/107 (54%)
 Frame = +1

Query: 16  EMQLKVKKVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAI 195
           E++ + + ++++  ES+ +L NEPS+ALYRLQEH  RSLP L   +  +        GA 
Sbjct: 13  EIESRSRIISERICESVRLLDNEPSLALYRLQEHTVRSLPGLVNRRIMLTQQSATLSGAQ 72

Query: 196 YTVEYACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNAAQGRSAVA 336
           + +E   S   SM +++  F +   LL++ +  K QL+    R A +
Sbjct: 73  FDLENTLSTTTSMQNATSAFDNCIELLRNCMFYKQQLDFDSTRKATS 119


  Database: sp_tr_nrdb
    Posted date:  Sep 24, 2003  2:13 PM
  Number of letters in database: 406,886,216
  Number of sequences in database:  1,272,877
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 542,902,457
Number of Sequences: 1272877
Number of extensions: 11930614
Number of successful extensions: 44594
Number of sequences better than 1.0e-03: 14
Number of HSP's better than  0.0 without gapping: 41948
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44535
length of database: 406,886,216
effective HSP length: 118
effective length of database: 256,686,730
effective search space used: 25155299540
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)