BLASTX 2.2.3 [Apr-24-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 603870857F1
         (595 letters)

Database: sp_tr_nrdb 
           1,272,877 sequences; 406,886,216 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q96FH0 (Q96FH0) Similar to RIKEN cDNA 2310045N01 gene                 164   6e-40
Q9D6Y4 (Q9D6Y4) 2310045N01Rik protein                                 161   6e-39
Q9BWB3 (Q9BWB3) Hypothetical protein (Fragment)                       159   2e-38
Q9BT01 (Q9BT01) Similar to RIKEN cDNA 2310045N01 gene                 159   2e-38
EAA10220 (EAA10220) AgCP15219 (Fragment)                               85   7e-16
Q8IR45 (Q8IR45) CG32590-PA                                             73   3e-12
O45685 (O45685) K11B4.2 protein                                        60   1e-08

>Q96FH0 (Q96FH0) Similar to RIKEN cDNA 2310045N01 gene
          Length = 119

 Score =  164 bits (416), Expect = 6e-40
 Identities = 82/111 (73%), Positives = 97/111 (86%), Gaps = 1/111 (0%)
 Frame = +1

Query: 19  EVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEYAC 198
           +VTDKFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQSQGAIYTVEYAC
Sbjct: 12  KVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYAC 71

Query: 199 SAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNA-AQGRSAVAPQAKNPPGSS 348
           SA+K++ DSSVYF+S++ LLK AI+++D +NA AQG S   P+   PP S+
Sbjct: 72  SAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHS---PEEPPPPSSA 119


>Q9D6Y4 (Q9D6Y4) 2310045N01Rik protein
          Length = 120

 Score =  161 bits (407), Expect = 6e-39
 Identities = 81/110 (73%), Positives = 96/110 (86%), Gaps = 1/110 (0%)
 Frame = +1

Query: 19  EVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEYAC 198
           +VTDKFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQSQGAIYTVEYAC
Sbjct: 12  KVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYAC 71

Query: 199 SAIKSMTDSSVYFKSIDSLLKHAIAMKDQLN-AAQGRSAVAPQAKNPPGS 345
           SA+KS+ DSSVYF+S++ LLK AI+++D +N +AQG S    +  +PP S
Sbjct: 72  SAVKSLVDSSVYFRSVEGLLKQAISIRDHMNTSAQGHS---QEKLSPPPS 118


>Q9BWB3 (Q9BWB3) Hypothetical protein (Fragment)
          Length = 119

 Score =  159 bits (402), Expect = 2e-38
 Identities = 77/96 (80%), Positives = 90/96 (93%), Gaps = 1/96 (1%)
 Frame = +1

Query: 19  EVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEYAC 198
           +VTDKFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQSQGAIYTVEYAC
Sbjct: 22  KVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYAC 81

Query: 199 SAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNA-AQG 303
           SA+K++ DSSVYF+S++ LLK AI+++D +NA AQG
Sbjct: 82  SAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQG 117


>Q9BT01 (Q9BT01) Similar to RIKEN cDNA 2310045N01 gene
          Length = 109

 Score =  159 bits (402), Expect = 2e-38
 Identities = 77/96 (80%), Positives = 90/96 (93%), Gaps = 1/96 (1%)
 Frame = +1

Query: 19  EVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEYAC 198
           +VTDKFTES+YVLANEPSVALYRLQEHVRRSLPELAQHK+DMQ WEEQSQGAIYTVEYAC
Sbjct: 12  KVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYAC 71

Query: 199 SAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNA-AQG 303
           SA+K++ DSSVYF+S++ LLK AI+++D +NA AQG
Sbjct: 72  SAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQG 107


>EAA10220 (EAA10220) AgCP15219 (Fragment)
          Length = 196

 Score = 84.7 bits (208), Expect = 7e-16
 Identities = 36/96 (37%), Positives = 64/96 (66%)
 Frame = +1

Query: 19  EVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEYAC 198
           + T+K +E+M+++ANEPS+A YR+QEHVR+ +P + + ++++   ++  QG  Y +EYA 
Sbjct: 30  KTTEKISENMHIIANEPSLAFYRIQEHVRKVIPLIVERRAEVVQLQQDLQGKCYDMEYAI 89

Query: 199 SAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNAAQGR 306
            A+K +  +    K++  LLK+AI +K QL   + R
Sbjct: 90  GAVKDIEAADTSLKNVQELLKNAIFLKQQLKYVESR 125


>Q8IR45 (Q8IR45) CG32590-PA
          Length = 183

 Score = 72.8 bits (177), Expect = 3e-12
 Identities = 34/120 (28%), Positives = 67/120 (55%)
 Frame = +1

Query: 13  AAEVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEY 192
           A + ++K +E++++ AN+PS+A +R+QEHVR+  P + + + ++   +   QG  Y +EY
Sbjct: 11  AKKTSEKISENIHIFANDPSLAFFRVQEHVRKVTPAIFEKRDEVFQLQNNLQGHCYDMEY 70

Query: 193 ACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNAAQGRSAVAPQAKNPPGSS*FQTRLAV 372
              A++++  S   F++I  ++K +I +K QL   + R  V   +        F   LA+
Sbjct: 71  GIQALRTIEKSESIFENIQEMIKASIFLKQQLKYEESRKKVKKDSTKSSVYKRFSAHLAL 130


>O45685 (O45685) K11B4.2 protein
          Length = 151

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 34/99 (34%), Positives = 54/99 (54%)
 Frame = +1

Query: 22  VTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQSQGAIYTVEYACS 201
           ++++  ES+ +L NEPS+ALYRLQEH  RSLP L   +  +        GA + +E   S
Sbjct: 21  ISERICESVRLLDNEPSLALYRLQEHTVRSLPGLVNRRIMLTQQSATLSGAQFDLENTLS 80

Query: 202 AIKSMTDSSVYFKSIDSLLKHAIAMKDQLNAAQGRSAVA 318
              SM +++  F +   LL++ +  K QL+    R A +
Sbjct: 81  TTTSMQNATSAFDNCIELLRNCMFYKQQLDFDSTRKATS 119


  Database: sp_tr_nrdb
    Posted date:  Sep 24, 2003  2:13 PM
  Number of letters in database: 406,886,216
  Number of sequences in database:  1,272,877
  
Lambda     K      H
   0.318    0.129    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 492,124,972
Number of Sequences: 1272877
Number of extensions: 10473222
Number of successful extensions: 40274
Number of sequences better than 1.0e-03: 14
Number of HSP's better than  0.0 without gapping: 38525
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40243
length of database: 406,886,216
effective HSP length: 116
effective length of database: 259,232,484
effective search space used: 20997831204
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)