BLASTX 2.2.3 [Apr-24-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 603231575F1
         (678 letters)

Database: sp_tr_nrdb 
           1,272,877 sequences; 406,886,216 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q96FH0 (Q96FH0) Similar to RIKEN cDNA 2310045N01 gene                  56   4e-07
Q9D6Y4 (Q9D6Y4) 2310045N01Rik protein                                  53   4e-06
Q9BWB3 (Q9BWB3) Hypothetical protein (Fragment)                        51   2e-05
Q9BT01 (Q9BT01) Similar to RIKEN cDNA 2310045N01 gene                  51   2e-05

>Q96FH0 (Q96FH0) Similar to RIKEN cDNA 2310045N01 gene
          Length = 119

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 28/53 (52%), Positives = 40/53 (74%), Gaps = 1/53 (1%)
 Frame = +3

Query: 3   ACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNA-AQGRSAVAPQAKNPPGSS 158
           ACSA+K++ DSSVYF+S++ LLK AI+++D +NA AQG S   P+   PP S+
Sbjct: 70  ACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHS---PEEPPPPSSA 119


>Q9D6Y4 (Q9D6Y4) 2310045N01Rik protein
          Length = 120

 Score = 52.8 bits (125), Expect = 4e-06
 Identities = 27/52 (51%), Positives = 39/52 (74%), Gaps = 1/52 (1%)
 Frame = +3

Query: 3   ACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLN-AAQGRSAVAPQAKNPPGS 155
           ACSA+KS+ DSSVYF+S++ LLK AI+++D +N +AQG S    +  +PP S
Sbjct: 70  ACSAVKSLVDSSVYFRSVEGLLKQAISIRDHMNTSAQGHS---QEKLSPPPS 118


>Q9BWB3 (Q9BWB3) Hypothetical protein (Fragment)
          Length = 119

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 23/38 (60%), Positives = 33/38 (86%), Gaps = 1/38 (2%)
 Frame = +3

Query: 3   ACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNA-AQG 113
           ACSA+K++ DSSVYF+S++ LLK AI+++D +NA AQG
Sbjct: 80  ACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQG 117


>Q9BT01 (Q9BT01) Similar to RIKEN cDNA 2310045N01 gene
          Length = 109

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 23/38 (60%), Positives = 33/38 (86%), Gaps = 1/38 (2%)
 Frame = +3

Query: 3   ACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNA-AQG 113
           ACSA+K++ DSSVYF+S++ LLK AI+++D +NA AQG
Sbjct: 70  ACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQG 107


  Database: sp_tr_nrdb
    Posted date:  Sep 24, 2003  2:13 PM
  Number of letters in database: 406,886,216
  Number of sequences in database:  1,272,877
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 569,686,754
Number of Sequences: 1272877
Number of extensions: 13314590
Number of successful extensions: 42424
Number of sequences better than 1.0e-03: 8
Number of HSP's better than  0.0 without gapping: 40069
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42383
length of database: 406,886,216
effective HSP length: 118
effective length of database: 256,686,730
effective search space used: 27465480110
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)